DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CG7763

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:187 Identity:56/187 - (29%)
Similarity:96/187 - (51%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DLHSKLEYLDAAL---QKAIN-----------SLQCSLKNT--KVMSTG-------KPHPEFQKL 135
            :|..::|..:||:   :.|:|           :||...:||  ::::.|       :.:..||:|
  Fly    48 NLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQL 112

  Fly   136 GSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEA-RWFWLDISNLVDKDQYI 199
            ||:|:|||:..:.||.||.|||.:||||||:.|.::||.....||.. ..:|:|::|..::.:::
  Fly   113 GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFV 177

  Fly   200 SLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTY---------QCSDRNFFICQ 247
            |:..|.:.::|.|..|||.|.  ..|.     |..|:         .|....:|||:
  Fly   178 SVTKGSKANFLSWADGEPTKD--GECV-----DIRTFNGKTTMNDNSCFANLYFICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 40/119 (34%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.900

Return to query results.
Submit another query.