DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Acp29AB

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:284 Identity:71/284 - (25%)
Similarity:116/284 - (40%) Gaps:94/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDTYFLYLIVL-----------------------------LDPQGAQEN-----NCPK----VSL 30
            |.:..|||:.|                             :|..|..:|     |..|    :::
  Fly     2 YASNLLYLLALWNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAI 66

  Fly    31 SERLEKRGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDL 95
            .:.:|.|...||:||.                      ...|.:|||:|.::.:.:..:      
  Fly    67 IDTMEMRIASSLLEFK----------------------AQMEIQLQPLKIIMRHHASNI------ 103

  Fly    96 HSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRM 160
                        ||.|:::..              .|:|:|||:|:||:::.|.||:|...||:|
  Fly   104 ------------KASNNIKMR--------------RFEKVGSRHFHIEKNLMQTWFEAYVTCRKM 142

  Fly   161 GGHLATPQDEDELYLIRKQLEARWFWLDISNLVDK-DQYISLATGKEVSYLKWRHGEPKKSSTAN 224
            .||||..|||.||..|........:|:|||.||:. ..::|..||:|..::||:..:..|... .
  Fly   143 NGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKN-Q 206

  Fly   225 CAYLYAGDYYTYQCSDRNFFICQA 248
            |.|:||.:....:|.::..|:|||
  Fly   207 CVYIYAKEMSYDECFEKKSFVCQA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 41/110 (37%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 39/108 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448761
Domainoid 1 1.000 54 1.000 Domainoid score I11184
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.