DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CG15818

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:128/279 - (45%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYDTYFLYLIVLLDPQG----AQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVK------- 54
            ||......|...:||.|.|    |||.......||:...:..|:.:....|::..:.|       
  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGA 65

  Fly    55 -----NPHKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQ 114
                 |.....|.:||..:..|:.:::..::.:.|.....:...||..||:.::.......|.|:
  Fly    66 CEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLK 130

  Fly   115 CSLKNTKVMSTGKPH-----------PEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQ 168
            ...|.|:...|....           ..:|::||||||||.:::.||..|..:|..||||||..|
  Fly   131 DGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQ 195

  Fly   169 DEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPK-KSSTANCAYLYAGD 232
            :.:|...|..||....:||.:::|..:.::||||:||..:|.|||..||| .:.|.:|||::..:
  Fly   196 NAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGHE 260

  Fly   233 --YYTYQC-SDRNFFICQA 248
              .....| :|...||||:
  Fly   261 NIMIVLSCTTDVMHFICQS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 46/113 (41%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 46/113 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448784
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.