DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CG12111

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:67/133 - (50%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEAR------WFWLDIS 190
            |.::|..|:|||...:.|||.||..||.|..|||:.:|:.|:..:.|.::|:      :||:..:
  Fly    48 FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGN 112

  Fly   191 NLVDKDQYISLATGKEVSYLKWRHGEPKK-----SSTANCAYLYA-----GDYYTYQCSDRNFFI 245
            :|..:..:..::.|:.::|..|  ..||:     ....||.:::|     .|   ..|..:..::
  Fly   113 DLGTEGAFYWMSNGRPMTYAPW--NGPKQMPDNYGGNENCVHMFATREMIND---ANCKIQMLYV 172

  Fly   246 CQA 248
            |:|
  Fly   173 CEA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 32/125 (26%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.