DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Colec10

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:149 Identity:36/149 - (24%)
Similarity:69/149 - (46%) Gaps:11/149 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDE 170
            |..::..|:.|:|..|.:..|     .::...:::||.:. .:|:.::...||..||.||.|:||
  Rat   131 LDISVARLKTSMKFIKNVIAG-----IRETEEKFYYIVQE-EKNYRESLTHCRIRGGMLAMPKDE 189

  Fly   171 DELYLIRKQLEARWF---WLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCA-YLYA 230
            ....||...:....|   ::.:::|..:.||:........:|..|:.|||... ...:|. .|.:
  Rat   190 VVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHEDCVEMLSS 254

  Fly   231 GDYYTYQCSDRNFFICQAV 249
            |.:...:|....:|:|:.|
  Rat   255 GRWNDTECHLTMYFVCEFV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/114 (25%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10071
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.