DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec11a

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001012477.1 Gene:Clec11a / 29313 RGDID:3627 Length:328 Species:Rattus norvegicus


Alignment Length:249 Identity:51/249 - (20%)
Similarity:86/249 - (34%) Gaps:68/249 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EIEGLVGHTENKLQPMKSVIP-----NQSKALLNYL------------DLHSKLEYLDA------ 104
            |.:|.....|....|..|..|     ..|:..:.|:            .||.:|..||.      
  Rat    81 ETQGEEEEEETTTTPSSSPTPFPSPSPTSEDTVTYILGRLASLDAGLHQLHIRLHVLDTRVVELT 145

  Fly   105 --------ALQKAINSLQCSLKNTKVMSTGKPHPEFQ------KLGSRYFYIERHVRQNWFDAAD 155
                    |.....:|:| :||..:|.|. :.|...:      :||.:.|.:.|.. :....|..
  Rat   146 QGLRRLRDAASDTRDSVQ-ALKEVQVRSE-QEHGRLEGCLKGLRLGHKCFLLSRDF-ETQAAAQA 207

  Fly   156 KCRRMGGHLATPQDEDELYLIRKQLEA-----RW-FWLDISNLVDKDQYISLATGKEVSYLKWRH 214
            :|:..||.||.|.|..::..:.:.|.|     .| .||.:.:...:..|: ...|:.||:..|..
  Rat   208 RCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYL-FENGQRVSFFAWHR 271

  Fly   215 G-------------------EPKKSSTANCAYLYA--GDYYTYQCSDRNFFICQ 247
            .                   :|......||....:  |.::.:.|..|.:|:|:
  Rat   272 ALSPESGAQPSAASHPLSPDQPNGGILENCVAQASDDGSWWDHDCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/136 (20%)
Clec11aNP_001012477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..111 7/29 (24%)
CLECT 182..326 CDD:413318 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.