DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4m

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:240 Identity:53/240 - (22%)
Similarity:80/240 - (33%) Gaps:78/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYL------------DLHSKLEYLDAALQKAIN 111
            ||:..|....|..|:..:.:...:......||:.:            .:..:|..|.|.|...|.
  Rat   111 ELMSRIPISQGQNESMQEKISEQLTQLKVELLSRIPVFQVQNESMQEKISEQLTQLKAELLSKIP 175

  Fly   112 SLQCSLKNTKVMSTGKPHPEFQK----------------------LGSRYFYIERHVRQNWFDAA 154
            |||       |....|....:|:                      ||:.||..:.  ::||.||.
  Rat   176 SLQ-------VQDESKQEKIYQQLVQMKTELLRLCRLCPWDWTFLLGNCYFLSKS--QRNWNDAV 231

  Fly   155 DKCRRMGGHLA-TPQDEDELYLIRKQL-----------------EARWFWLDISNLVDKDQYISL 201
            ..|:.....|. ...||::.:|   ||                 ||.|.|:|.|.|..:.|    
  Rat   232 RACKEEKAQLVIINSDEEQTFL---QLTSKAKGPTWMGLSDLKNEATWLWVDGSTLSSRFQ---- 289

  Fly   202 ATGKEVSYLKWRHGEPKKSSTANCAYLYAGD-YYTYQCSDRNFFI 245
                  .|  |..|||......:|.. :||| :...:|..:.|:|
  Rat   290 ------KY--WNRGEPNNIGEEDCVE-FAGDGWNDSKCELKKFWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 33/128 (26%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.