DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Mbl1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:149 Identity:36/149 - (24%)
Similarity:67/149 - (44%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AALQKAINSLQCSLKNTK---VMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLA 165
            |.::..||:|:..|:.|.   ..|.||      |.|.: |::..|.|..:......|..:.|.:|
  Rat    96 ANMEAEINTLKSKLELTNKLHAFSMGK------KSGKK-FFVTNHERMPFSKVKALCSELRGTVA 153

  Fly   166 TPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPK-KSSTANCAYLY 229
            .|::.:|...|::..:...| |.|::.|.:.|:: ..||..::|..|:..||. ..|..:|..:.
  Rat   154 IPRNAEENKAIQEVAKTSAF-LGITDEVTEGQFM-YVTGGRLTYSNWKKDEPNDHGSGEDCVTIV 216

  Fly   230 -AGDYYTYQCSDRNFFICQ 247
             .|.:....|...:..:|:
  Rat   217 DNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/111 (22%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 25/113 (22%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.