DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and FCER2

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:239 Identity:54/239 - (22%)
Similarity:91/239 - (38%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGAQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVGHTENKLQPMKSVI 82
            |.||::...::| .|..|.|.|          :..:|:...||...:.||    :..|...||..
Human    78 QMAQKSQSTQIS-QELEELRAE----------QQRLKSQDLELSWNLNGL----QADLSSFKSQE 127

  Fly    83 PNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTG---KPHPE----FQKLGSRYF 140
            .|:.....:.|:          .|::.:..|:..|:    :|:|   ...||    ||:   :.:
Human   128 LNERNEASDLLE----------RLREEVTKLRMELQ----VSSGFVCNTCPEKWINFQR---KCY 175

  Fly   141 YIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGK 205
            |..:..:| |..|...|..|.|.|.:....:|...:.|.......|:.:.||..|.::| ...|.
Human   176 YFGKGTKQ-WVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFI-WVDGS 238

  Fly   206 EVSYLKWRHGEP-KKSSTANCAYLYAGDYYTYQCSDRNF--FIC 246
            .|.|..|..||| .:|...:|..:.....:.....||..  ::|
Human   239 HVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/113 (24%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85 3/6 (50%)
Repetitive region 69..89 3/10 (30%)
RILP-like <77..153 CDD:304877 20/99 (20%)
Repetitive region 90..110 6/29 (21%)
Repetitive region 111..131 6/23 (26%)
CLECT 163..282 CDD:214480 30/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.