DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec11a

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_033157.1 Gene:Clec11a / 20256 MGIID:1298219 Length:328 Species:Mus musculus


Alignment Length:261 Identity:50/261 - (19%)
Similarity:91/261 - (34%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IVKNPHKELLGEIEGLVGHTENK---LQPMKSVIPNQSKA-----LLNYL------------DLH 96
            :.:||..:.:.|.....|..|.:   ..|..|..|..|.:     .:.|:            .||
Mouse    67 LAENPEDKEVWETTETQGEEEEEEITTAPSSSPNPFPSPSPTPEDTVTYILGRLASLDAGLHQLH 131

  Fly    97 SKLEYLDA----------ALQKAINSLQCSLKNTKVMS--TGKPHPEFQ------KLGSRYFYIE 143
            .:|..||.          .|:.|.:..:.|::..|.:.  ..:.|...:      :||.:.|.:.
Mouse   132 VRLHVLDTRVVELTQGLRQLRDAASDTRDSVQALKEVQDRAEQEHGRLEGCLKGLRLGHKCFLLS 196

  Fly   144 RHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEA-----RW-FWLDISNLVDKDQYISLA 202
            |.. :....|..:|:..||.||.|.|..::..:.:.|.|     .| .||.:.:...:..|: ..
Mouse   197 RDF-ETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYL-FE 259

  Fly   203 TGKEVSYLKWRHG-------------------EPKKSSTANCAYLYA--GDYYTYQCSDRNFFIC 246
            .|:.||:..|...                   :|......||....:  |.::.:.|..|.:|:|
Mouse   260 NGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVC 324

  Fly   247 Q 247
            :
Mouse   325 E 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/136 (20%)
Clec11aNP_033157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..111 9/43 (21%)
CLECT 182..326 CDD:295302 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.