DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and clec-27

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_507257.2 Gene:clec-27 / 190826 WormBaseID:WBGene00013607 Length:363 Species:Caenorhabditis elegans


Alignment Length:177 Identity:41/177 - (23%)
Similarity:62/177 - (35%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NQSKALLNYLDLHSKL-EYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLG-SRYFYIERHV 146
            |.:...:.|:...|:. ::.:.|..||: |..|.|..|       .|.|..|.. :.|.||....
 Worm   205 NVTGGCIYYMTTGSQAGQWTNGACNKAL-SFVCELPAT-------IHDETCKYNYNNYCYITNDQ 261

  Fly   147 RQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVS--Y 209
            .:...||...|...|.:|.:         |....|.|:.....|..|       |..|...|  .
 Worm   262 LKISSDAQQICTSSGSNLVS---------IHSANENRFLTTIYSPPV-------LVGGVAFSSNL 310

  Fly   210 LKWRHGEP------KKSSTANCAYL--YAGDYYTYQC-SDRNFFICQ 247
            :.|..|.|      |..:..||.::  ..|.:|.:.| :....|||:
 Worm   311 ILWYDGTPSTFNNIKSITNGNCLFINDTHGGWYGFDCFTGSGDFICK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/120 (23%)
clec-27NP_507257.2 CLECT 109..237 CDD:214480 7/32 (22%)
CLECT 251..357 CDD:214480 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D254639at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.