DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and clec-149

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:203 Identity:43/203 - (21%)
Similarity:81/203 - (39%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLK--------- 118
            :||.|....:.||..:|               :|::.|     .:|.:..|:...:         
 Worm   126 DIEALEAKFDKKLYEVK---------------MHAQYE-----TEKGVGDLRKQFETDLREYERI 170

  Fly   119 NTKVMSTGKPH------PEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIR 177
            .||.:...|.|      |........||:|:|  .::|:.|::||...|.|||:.....||..::
 Worm   171 TTKDIVEIKRHLDYLQAPRITNNDLEYFFIQR--EESWYTASEKCIGYGAHLASIHSRLELGFVQ 233

  Fly   178 KQLEA-RWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEP-KKSSTANCAYL-YAGDYYTYQCS 239
            :.:.. :..|:.: |.:.|:.....:.|..|.:.||...:| .:....||..: ::|.:....|.
 Worm   234 RLVPVNQTAWIGV-NDIQKENVFRNSDGTPVDFYKWGKKQPDNQEHNENCVEVDHSGQWTDKLCI 297

  Fly   240 DRNFFICQ 247
            ....|:|:
 Worm   298 ITRPFVCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/112 (24%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.