DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and F52E1.2

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:212 Identity:46/212 - (21%)
Similarity:69/212 - (32%) Gaps:76/212 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SKLEYLDAALQKAINSLQ-----------CSLKNTKVMSTGKPH--------------------- 129
            :.|.:|...|...:|||.           .::..|.:::|..|.                     
 Worm     3 TSLAFLIVLLVSTVNSLDLNDIKKIKTNPTTISTTTLLTTTTPEYVTFTIVDPGAMLIDCPGGCP 67

  Fly   130 PEFQKLGSRYFYIERHVRQNWFDAA-------DKCRRMGGHLATPQDEDELYLIRKQLEARWFWL 187
            ..:|.|.|:.:        ..||||       ..|...|..|.|....||...:||.       .
 Worm    68 TGWQYLNSKCY--------KKFDAAVTYAGATSACAAQGAELVTIDSFDENDALRKA-------F 117

  Fly   188 DISNLVD--KDQYISL---------ATGKEVSYLKWRHGEPKKS---------STANCAYLY-AG 231
            |.:.|||  |:.:|.|         |.|...:|..|...:|..:         |.:|..|.| .|
 Worm   118 DTNALVDETKETWIGLKSLSGAWQWADGSSATYTNWAPSQPSSNGLCVQMITDSLSNATYKYQRG 182

  Fly   232 DYYTYQCSDRN-FFICQ 247
            .:.||.|...: .:||:
 Worm   183 GWKTYGCGKTSASYICE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 34/138 (25%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.