DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and clec-198

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503091.3 Gene:clec-198 / 183598 WormBaseID:WBGene00008203 Length:499 Species:Caenorhabditis elegans


Alignment Length:84 Identity:26/84 - (30%)
Similarity:36/84 - (42%) Gaps:14/84 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 WFDAADKC--RRMGGHLATPQDEDEL-YLIRKQLEARWF-----WLDISNLVDKDQYISLATGKE 206
            |:.|.|.|  :|.|.||.:...|.|. ::....:...||     ||.:....|...|| ...|..
 Worm   108 WYAAEDWCYSQRYGSHLTSVHSEAEAQWIAATYVSTGWFPYMDNWLGLRRSCDNSTYI-WTDGTP 171

  Fly   207 VSYLKWR-----HGEPKKS 220
            |.||.|:     .|:|:||
 Worm   172 VDYLWWQPGYPGSGDPEKS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 26/84 (31%)
clec-198NP_503091.3 CLECT 85..198 CDD:214480 26/84 (31%)
CLECT 371..497 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.