Sequence 1: | NP_608539.2 | Gene: | lectin-21Cb / 33242 | FlyBaseID: | FBgn0040106 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502375.4 | Gene: | clec-185 / 182914 | WormBaseID: | WBGene00007729 | Length: | 504 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 33/197 - (16%) |
---|---|---|---|
Similarity: | 64/197 - (32%) | Gaps: | 49/197 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 QSKALLNYLDLHSKLE---YLDAALQKAINSLQCSLKNTKVMSTGKPHP----EFQKLGSRYFYI 142
Fly 143 ERHVRQNWFDAADKCRRM--GGHLATPQDEDELYLIRKQLEA----------------------- 182
Fly 183 --RWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFI 245
Fly 246 CQ 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Cb | NP_608539.2 | CLECT | 137..247 | CDD:153057 | 20/136 (15%) |
clec-185 | NP_502375.4 | CLECT | 84..217 | CDD:214480 | 22/146 (15%) |
CLECT | 391..500 | CDD:214480 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |