DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and clec-48

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_507547.1 Gene:clec-48 / 180188 WormBaseID:WBGene00007565 Length:321 Species:Caenorhabditis elegans


Alignment Length:117 Identity:27/117 - (23%)
Similarity:41/117 - (35%) Gaps:39/117 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 AADKCRRMGGHLATPQDEDELYLIRK---------------------QLEARWFWLDISNLVDKD 196
            |..:|..:|||||:.|:..|..|::.                     :....|.|.|.|...|  
 Worm    46 AEQQCNLLGGHLASVQNGQENALLQSNAANSFKKSNYSDYWIGANDLETSGTWKWTDPSVTFD-- 108

  Fly   197 QYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGD--YYTYQCSDRNFFIC 246
                        |..|:.|||:..|  :||....||  :....|:....::|
 Worm   109 ------------YSNWQLGEPQSGS--DCAIQDKGDGTWSAIGCTSYRPYLC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/117 (23%)
clec-48NP_507547.1 CLECT 26..146 CDD:214480 26/115 (23%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.