DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4d

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_034949.3 Gene:Clec4d / 17474 MGIID:1298389 Length:219 Species:Mus musculus


Alignment Length:103 Identity:23/103 - (22%)
Similarity:32/103 - (31%) Gaps:28/103 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 YIERHVRQNWFDAADKCRRMGGHLATPQDEDE---------------LYLIRKQLEARWFWLDIS 190
            |...:..|.|.::...|..|..||.|...|.|               |.|..:.:|.:|.|    
Mouse    95 YFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQW---- 155

  Fly   191 NLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYL 228
              |||..:       ....:.|..||.......:|..|
Mouse   156 --VDKTPF-------NPHTVFWEKGESNDFMEEDCVVL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 23/103 (22%)
Clec4dNP_034949.3 CLECT_DC-SIGN_like 83..207 CDD:153060 23/103 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.