DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Mbl2

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:270 Identity:63/270 - (23%)
Similarity:104/270 - (38%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TYFLYLIVLLD------PQGAQENNCPKVSLSERLEKRGEFSLVEFDPLLK-FIVKNPHKELLGE 63
            |.||.|.|:..      .:|.| |:||.|:.|              .|.|. |..|:......||
Mouse     5 TSFLLLCVVTVVYAETLTEGVQ-NSCPVVTCS--------------SPGLNGFPGKDGRDGAKGE 54

  Fly    64 -------IEGLVGHTENKLQP--------MKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSL 113
                   :.||.| ...|:.|        :|..:..:.       |...:.|:..:.:...|.:|
Mouse    55 KGEPGQGLRGLQG-PPGKVGPTGPPGNPGLKGAVGPKG-------DRGDRAEFDTSEIDSEIAAL 111

  Fly   114 QC---SLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADK-CRRMGGHLATPQDEDELY 174
            :.   :|:|..:.|..      :|:|.:||.  ..|::...|.... |....|.:|||::.:|..
Mouse   112 RSELRALRNWVLFSLS------EKVGKKYFV--SSVKKMSLDRVKALCSEFQGSVATPRNAEENS 168

  Fly   175 LIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTA-NCAYLYA-GDYYTYQ 237
            .|:| :.....:|.|:::..:..:..| ||..|.|..|..|||..:... :|..:.. |.:....
Mouse   169 AIQK-VAKDIAYLGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVP 231

  Fly   238 CSDRNFFICQ 247
            |||....||:
Mouse   232 CSDSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 29/112 (26%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968 12/64 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101 12/68 (18%)
CLECT 132..242 CDD:382969 30/114 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.