DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Mbl1

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:148 Identity:29/148 - (19%)
Similarity:63/148 - (42%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ALQKAINSLQCSLK--NTKVMSTGKPHP-EFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLAT 166
            |:::.:.:::..::  .:|:..|.|.|. ...|...:..::..|.:..:......|..:.|.:|.
Mouse    91 AIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAI 155

  Fly   167 PQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKK-SSTANCAYLYA 230
            |::.:|...|::......| |.|::...:.|:: ..||..::|..|:..||.. .|..:|..:..
Mouse   156 PRNAEENKAIQEVATGIAF-LGITDEATEGQFM-YVTGGRLTYSNWKKDEPNNHGSGEDCVIILD 218

  Fly   231 GDYYTYQCSDRNFFICQA 248
            ...:       |...|||
Mouse   219 NGLW-------NDISCQA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 20/110 (18%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88
Collagen <37..89 CDD:460189
CLECT_collectin_like 127..237 CDD:153061 23/112 (21%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.