DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Cd209c

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:162 Identity:39/162 - (24%)
Similarity:67/162 - (41%) Gaps:49/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LQKAINSLQCSLKNTKVMSTGKPHP----EFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLAT 166
            |:..||.| |           :|.|    .||  |:.||:.:  .:|||.|:.:.||::...|..
Mouse    99 LKSQINRL-C-----------RPCPWDWTVFQ--GNCYFFSK--FQQNWNDSVNACRKLDAQLVV 147

  Fly   167 PQDEDELYLIRK---------------QLEARWFWLDISNLVDKDQYISLATGKEVSYLK-WRHG 215
            .:.:||...:::               :.|.||.|:|.|:|:             .|::| |..|
Mouse   148 IKSDDEQSFLQQTSKEKGYAWMGLSDLKHEGRWHWVDGSHLL-------------FSFMKYWNKG 199

  Fly   216 EPKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            ||......:||......:....|:.:.::||:
Mouse   200 EPNNEWEEDCAEFRGDGWNDAPCTIKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/125 (22%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.