DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CG43055

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:66/136 - (48%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDEL-----YLIRKQLEARWFWL 187
            |...|.|:|..|::||..:.:||:||.:.||:|...|...:|..|.     ||:..:::.. :|.
  Fly    38 PTAPFVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTT-YWT 101

  Fly   188 DISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANC---------AYLYAGDYYTYQCSDRN 242
            ..::|.::|.::..:.|:.|:...|.:.||..: :..:|         |.:...|..   |:.:.
  Fly   102 AGTDLAEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRV---CTFKT 163

  Fly   243 FFICQA 248
            .:||:|
  Fly   164 GYICRA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/124 (23%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.