DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4f

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:315 Identity:58/315 - (18%)
Similarity:114/315 - (36%) Gaps:122/315 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGAQENNCPKV-SLSERLEKRGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVGH---TENKLQPM 78
            |.:.:|...:: ::.:.:::.||    |...|.|.:     :.|..:|:...||   |:.::|.:
  Rat   250 QHSMDNISAEIQAMRDGMQRAGE----EMTSLKKDL-----ETLTAQIQNANGHLEQTDTQIQGL 305

  Fly    79 KSVIPNQS------------------------KALLNYLDLHSKLEYLDAALQKA---INSLQCS 116
            |:.:.:.|                        :.|.:...|.|.::.|.:.||||   :.||:..
  Rat   306 KAQLKSTSSLNSQIEVVNGKLKDSSRELQTLRRDLSDVSALKSNVQMLQSNLQKAKAEVQSLKTG 370

  Fly   117 LKNTKVMST---GK------------PHPEFQK---------------LGSRYFYIERHVRQNWF 151
            |:.||.::.   |:            .|.:.||               ...:::|..|. :::|.
  Rat   371 LEATKTLAAKIQGQQSDLEALQKAVAAHTQGQKTQNQVLQLIMQDWKYFNGKFYYFSRD-KKSWH 434

  Fly   152 DAADKCRRMGGHLAT-PQDEDELYLIR-------------KQLEARWFWLDISNLVDKDQYISLA 202
            :|.:.|...|.|||: ...|::.:|::             :..|..|.|:|              
  Rat   435 EAENFCVSQGAHLASVTSQEEQAFLVQITNAVDHWIGLTDQGTEGNWRWVD-------------- 485

  Fly   203 TGKEVSYLK------------WRHGEPKKSSTANCAYLY-------AGDYYTYQC 238
             |....|::            ||||..::.   :|.:|.       .|..|.:.|
  Rat   486 -GTPFDYVQSRRFWRKGQPDNWRHGNGERE---DCVHLQRMWNDMACGTAYNWVC 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 26/135 (19%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008 29/148 (20%)
CLECT_DC-SIGN_like 414..538 CDD:153060 26/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.