DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC4M

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:231 Identity:53/231 - (22%)
Similarity:94/231 - (40%) Gaps:52/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PHKELLGEI-------EGLVGH--TENKLQPMKSVIPNQSKALLNYLDLHSKLE--YLD-AALQK 108
            |.|..|.||       :..||.  .::|||.:...: .:.||.:..|...|||:  |.: ..|:.
Human   173 PEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQEL-TELKAAVGELPEKSKLQEIYQELTQLKA 236

  Fly   109 AINSLQCSLKNTKV------MSTGKPHPEFQKL------------GSRYFYIERHVRQNWFDAAD 155
            |:..|....|..::      :.|.     |::|            |:.||.  .:.::||.|:..
Human   237 AVGELPDQSKQQQIYQELTDLKTA-----FERLCRHCPKDWTFFQGNCYFM--SNSQRNWHDSVT 294

  Fly   156 KCRRMGGHLATPQDEDELYLIRKQLEA--RWFWLDISNLVDKD--QYISLATGKEVS-----YLK 211
            .|:.:...|...:..:|...::.|...  |:.|:.:|:|..:.  |::.   |..:|     |  
Human   295 ACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVD---GSPLSPSFQRY-- 354

  Fly   212 WRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            |..|||..|...:||......:...:|...|::||:
Human   355 WNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/118 (23%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269 24/101 (24%)
DUF342 <140..251 CDD:302792 21/78 (27%)
CLECT_DC-SIGN_like 268..391 CDD:153060 29/130 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.