DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:ch211-133n4.7

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_017207814.2 Gene:si:ch211-133n4.7 / 101885926 ZFINID:ZDB-GENE-060503-665 Length:208 Species:Danio rerio


Alignment Length:158 Identity:32/158 - (20%)
Similarity:56/158 - (35%) Gaps:58/158 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLA 165
            |:.|..|      |.:..|||:|..     :.::|.:                  .|.|:     
Zfish    68 YVRALTQ------QSAQTNTKIMKR-----QLEELTA------------------NCSRV----- 98

  Fly   166 TPQDEDELYL---IRKQLEARWFWLDISNLVDKDQYISLATGKEV----SYLKWRHGEPKKSSTA 223
                :|:||:   :.|.|.|.:      :.|..|.:|..:..||:    |.:|.:....|....:
Zfish    99 ----KDDLYIKDSMMKDLTANY------SRVKDDLHIKDSMVKELTANNSRIKEQQSFYKAFRAS 153

  Fly   224 NCA------YLYAGDYYTYQCSDRNFFI 245
            |..      |.::.|..|:. |.|.|.:
Zfish   154 NMTAFQGKLYFFSSDKLTWS-SSRAFCV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 23/122 (19%)
si:ch211-133n4.7XP_017207814.2 Ly49 54..>124 CDD:312037 19/99 (19%)
CLECT 158..>195 CDD:321932 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.