DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:131 Identity:25/131 - (19%)
Similarity:45/131 - (34%) Gaps:32/131 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDE--------------LYLIRKQLEARWFWL 187
            |.::|:... .::|.|:...|:.....|.|..:..|              :.|...:.|.:|.|:
Zfish   145 SSFYYLSNE-SKSWTDSRGDCKGRKADLITINNRQEQDFVMTLTRNKEFWIGLTDSEKEGQWKWV 208

  Fly   188 DISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAG------DYYTYQCSDRNFFIC 246
            |.|         :|.||...|:....  ||...:..||...:..      .:..:.|.....:||
Zfish   209 DGS---------TLTTGFWASFRSIT--EPNGGTRENCVLTHLKRHPELIGWIDHNCDASYQWIC 262

  Fly   247 Q 247
            :
Zfish   263 E 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/129 (19%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.