DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:197 Identity:39/197 - (19%)
Similarity:74/197 - (37%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FIVKN------PHKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYL------- 102
            ||..|      ..::|:..|..:....:..|..:.::...:.|.|:|..:|....:.|       
Zfish    64 FIYTNNTNFAEERRQLITNIANITEDRDKLLTDIINLTKIKDKVLINITNLEEDRDELLNKITTF 128

  Fly   103 ----DAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGH 163
                :..|:|..|.|:...:..|.:........:|   |.::|:... |::|.::...|:..|..
Zfish   129 TKARNEILKKNANLLKDKDQLIKQLQVFGQEAYYQ---SSFYYLSSE-RKSWTESRRDCKDRGAD 189

  Fly   164 LATPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHG----EPKKSSTAN 224
            |....::.|...|.|......||:.::: .||:.......|..::...|...    ||....|.|
Zfish   190 LIIINNKQEQDFIMKITSNNEFWIGLTD-SDKEGIWKWVDGSNLTSRFWASSGSITEPNGRKTEN 253

  Fly   225 CA 226
            ||
Zfish   254 CA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 22/94 (23%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.