DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:dkey-187i8.2

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021335897.1 Gene:si:dkey-187i8.2 / 101882603 ZFINID:ZDB-GENE-121214-181 Length:635 Species:Danio rerio


Alignment Length:261 Identity:53/261 - (20%)
Similarity:90/261 - (34%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VSLSERLEKRGEFSL-------VEFDPLL--KFIVKNPHKELLGEIEGLVGHTENKLQPMKSVIP 83
            :|.|.||.|..|..|       .|.|.||  :|.:....:|||        |..:.:...:..|.
Zfish   393 LSESIRLSKEREELLDNNTKVTRERDQLLSERFSLTKEREELL--------HNNSNVIKERDEIG 449

  Fly    84 NQS--------KALLNYLDLHSKLEYL---DAALQKAINSLQCSLKN--TKVMSTGKPHPEFQKL 135
            ::|        :.:.|..||..:.:.|   :..|.|....|..::.:  .:.....|...|...:
Zfish   450 SKSIQLKKETEELIANNTDLTKERDRLFSENIRLTKEREELSSNISDLIEQRDQLTKEKTELSNM 514

  Fly   136 -GSRYF----YIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRK--------------QLE 181
             |..||    |....:.::|.::...|...|..|....:..|..::..              :.|
Zfish   515 DGWVYFQSSLYFLSSLTKSWEESRKDCIARGADLVIINNGKEQEMVNMICGDVLVWIGLTDIEEE 579

  Fly   182 ARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFIC 246
            ..|.|:|.|......:|             ||..||..:...||....|..:..::|.:.|.:||
Zfish   580 GTWKWVDGSKQTSGFRY-------------WRSREPNGNRKENCVLTDAHGWIDHRCHEANKWIC 631

  Fly   247 Q 247
            :
Zfish   632 E 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/127 (19%)
si:dkey-187i8.2XP_021335897.1 SMC_N <113..507 CDD:330553 25/121 (21%)
CLECT_DC-SIGN_like 515..633 CDD:153060 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.