DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and LOC100537272

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021324610.1 Gene:LOC100537272 / 100537272 -ID:- Length:2176 Species:Danio rerio


Alignment Length:164 Identity:37/164 - (22%)
Similarity:63/164 - (38%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NSLQCSLKNTKVMSTGKPHPE--------FQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATP 167
            |...|:.:...:.....|:|.        :|..||. .|..:..|::|..|...|.|.||.|.:.
Zfish   142 NDETCTSRRQYICKRPNPNPAPACDSANGWQGFGSS-CYRRKSSRKSWTAARSDCIRDGGDLVSI 205

  Fly   168 QDEDELYLIRKQLEARWF--WLDISNL--------VDKD-QYISLATGKEVSYLKWRHGEPKKSS 221
            ...||...:..:|::..|  |:..|.:        |..: ...|.:.....||:.|.:|:|..|.
Zfish   206 NSADEEQYVTSRLDSSAFDLWIGFSTMKCTTLSCEVQANATSFSWSDASAASYINWPNGQPDLSD 270

  Fly   222 TAN--CAYLYA------GDYYTYQCSDRNFFICQ 247
            .||  |..:..      |.:.|:.|.....::|:
Zfish   271 KANGVCTAMIKESGEDYGKWRTHVCRYERPYMCE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 30/128 (23%)
LOC100537272XP_021324610.1 CLECT_DC-SIGN_like 32..156 CDD:153060 2/13 (15%)
CLECT 169..304 CDD:214480 32/135 (24%)
CLECT 311..442 CDD:214480
CLECT 459..582 CDD:321932
CLECT 615..730 CDD:153057
Gal_Lectin 757..833 CDD:307994
FA58C 862..977 CDD:238014
LCCL <1000..1065 CDD:322054
CLECT 1088..1209 CDD:214480
CLECT 1227..1351 CDD:214480
CLECT 1384..1500 CDD:153057
CLECT 1527..1651 CDD:214480
CLECT 1671..1804 CDD:214480
CLECT 1822..1947 CDD:214480
CLECT 1964..2091 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D254639at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.