DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and asgr1

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002935447.4 Gene:asgr1 / 100487251 XenbaseID:XB-GENE-5998517 Length:211 Species:Xenopus tropicalis


Alignment Length:126 Identity:26/126 - (20%)
Similarity:54/126 - (42%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDE 170
            :.:|:::::..:..|:.....:....::|.....:||...:: ||.:|...|:.|...|.....|
 Frog    69 ISEAMDTIRQDILQTRQKEICQCDSGWKKFDGNCYYIVTTMK-NWTEARAICKSMNSDLVVINSE 132

  Fly   171 DELYLIRKQLEARWFWLDISNLVDKDQYISL-ATGKEVSYLKWRHGEPKKS-STANCAYLY 229
            .|...:....:...||:.:..  |||::..: .|....|...|..|||..| ...:|.:::
 Frog   133 REQNFLESLTDESEFWIGLKR--DKDRWRWVDGTLHNPSEGFWMKGEPNNSGGKEDCVHMW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 23/95 (24%)
asgr1XP_002935447.4 CLECT_DC-SIGN_like 91..211 CDD:153060 24/104 (23%)

Return to query results.
Submit another query.