DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:ch211-125e6.12

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001103299.1 Gene:si:ch211-125e6.12 / 100126100 ZFINID:ZDB-GENE-070912-36 Length:152 Species:Danio rerio


Alignment Length:109 Identity:30/109 - (27%)
Similarity:43/109 - (39%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDE----LYLIRKQL----------E 181
            ::::.|||.|.: .....||..|...|:|:||:||:..::.|    |.||....          |
Zfish    28 QWRRSGSRCFRL-FSTSVNWATAEKNCQRLGGNLASVLNDVENDFLLSLIPNSKRFFIGGYNVDE 91

  Fly   182 ARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANC 225
            ..|||.|               |....|..|..|||...:|.:|
Zfish    92 QNWFWSD---------------GSPFGYTNWCSGEPNNMNTEHC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 29/103 (28%)
si:ch211-125e6.12NP_001103299.1 CLECT 35..146 CDD:153057 28/102 (27%)

Return to query results.
Submit another query.