DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:ch211-214k5.3

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_009303575.2 Gene:si:ch211-214k5.3 / 100034611 ZFINID:ZDB-GENE-041210-206 Length:291 Species:Danio rerio


Alignment Length:264 Identity:55/264 - (20%)
Similarity:87/264 - (32%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TYFLYLIVLLDPQGAQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVK--NPHKELLGEIEGLV 68
            |..:.|.|.......|||..  .||:|           |.|.||..|..  ....:||..|.  .
Zfish    77 TAVIVLSVYTHTNYTQENRI--TSLTE-----------ERDQLLINITNLIEERDQLLININ--A 126

  Fly    69 GHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQ-CSLKNTKVMSTGKPHPEF 132
            |:.:|:         |.:|.....|..:..|...:..||:..|:|| |.                
Zfish   127 GNAQNQ---------NLTKEKNELLSKNDDLIIQNVQLQQVENNLQECR---------------- 166

  Fly   133 QKLGSRY-----FYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRK-------------- 178
            .||...:     ||.....::||.::...||..|..|....:::|...::|              
Zfish   167 NKLDGWFNYQSSFYFISSEKKNWSESTRNCRDRGADLIIINNKEEQDFVKKISGGDVVWIGLSDS 231

  Fly   179 QLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNF 243
            ..|..|.|:|..::....::             |...||......|||...:..:..|.|::...
Zfish   232 DEEGSWKWVDDPSMTSGFRF-------------WGTFEPNGKRGENCAVSRSSGWADYPCNNYFQ 283

  Fly   244 FICQ 247
            :||:
Zfish   284 WICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 23/128 (18%)
si:ch211-214k5.3XP_009303575.2 ATPgrasp_Ter 113..>187 CDD:330691 19/100 (19%)
CLECT_DC-SIGN_like 170..288 CDD:153060 24/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.