DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and hbl1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_009296948.2 Gene:hbl1 / 100007982 ZFINID:ZDB-GENE-070912-285 Length:297 Species:Danio rerio


Alignment Length:160 Identity:37/160 - (23%)
Similarity:63/160 - (39%) Gaps:29/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QKAINSLQCSLKNTK----VMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADK-CRRMGGHLAT 166
            :..|.||:..::|.|    .:........|:|:|.:|:..:|..  ..||...| |....|.|..
Zfish   144 ESVIESLKSEIQNLKAKIDTIEKAASFSNFRKVGQKYYVTDRIF--GTFDNGIKLCESSSGTLVV 206

  Fly   167 PQDEDE-LYLIRKQLEARWFWLDISNLVDKDQYISLA-----------TGKEVSYLKWRHGEPKK 219
            |:...| ..|:|....        |.|:::..||.:.           .||::::.||..|:|..
Zfish   207 PKSSAENQALVRVAAS--------SGLINEKPYIGVTDKETEGQFVDIEGKQLTFTKWGPGQPDD 263

  Fly   220 SSTA-NCAYL-YAGDYYTYQCSDRNFFICQ 247
            ...| :|..: .:|.:....|.|....||:
Zfish   264 YQGAQDCGVIDVSGTWDDGNCGDIRPIICE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/124 (23%)
hbl1XP_009296948.2 CLECT 178..294 CDD:321932 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.