DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:dkey-187j14.6

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001427728.1 Gene:si:dkey-187j14.6 / 100006680 ZFINID:ZDB-GENE-131121-572 Length:329 Species:Danio rerio


Alignment Length:106 Identity:28/106 - (26%)
Similarity:45/106 - (42%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEA----RWFWLDISNLVDKDQYISLATGKEV 207
            ::||.:|...||.....|.|.|.:|:...|:|.|..    .|..|..|..|.:..|.|    :::
Zfish    28 QKNWTEAQAFCREFYLDLPTVQTDDDRLEIQKALSGANHDTWVGLYGSICVWRWSYQS----QDL 88

  Fly   208 SYLKWRHGE-PKKSSTANCAYL-YAGDYYTYQCSDRNFFIC 246
            .:..|...| |...:.:.||.: ..|.:|...|:....|:|
Zfish    89 LFSAWALTEDPSPRTQSACAVIRNDGFWYATNCTQLKPFVC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/106 (26%)
si:dkey-187j14.6NP_001427728.1 None

Return to query results.
Submit another query.