DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:dkey-83f18.11

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001093553.1 Gene:si:dkey-83f18.11 / 100003110 ZFINID:ZDB-GENE-070705-496 Length:362 Species:Danio rerio


Alignment Length:120 Identity:24/120 - (20%)
Similarity:46/120 - (38%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 RYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQ-----------LEARWFWLDISN 191
            :|.:|..  .:.|.:|...||.....|||..:.:::..:.|.           |:.:|.|     
Zfish    24 QYHFINE--MKTWTEAQRYCREKYTDLATVDNMNDMIQLMKSVKVNDRGVWIGLQRKWQW----- 81

  Fly   192 LVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFIC 246
                      ::|....:|.|.:.:|  .....||::..|.:...:|:|...|:|
Zfish    82 ----------SSGDPALFLHWGNEQP--DGADECAFMRNGQWEDGKCNDSWIFVC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/120 (20%)
si:dkey-83f18.11NP_001093553.1 CLECT_1 23..126 CDD:153072 24/120 (20%)
CLECT 129..241 CDD:470576
CLECT 247..359 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.