DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and PXL1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_013016.4 Gene:PXL1 / 853965 SGDID:S000001798 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:61/296 - (20%)
Similarity:92/296 - (31%) Gaps:113/296 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STTPDIP---------PSKAKFKITVVSTPSPSPPP----------TPPPAGSMLAQMVETNSPP 66
            |..|.:|         .||:.:. :|.......|||          |||...:.      |:|.|
Yeast    63 SAAPSVPVTMKSAYTASSKSAYS-SVKGESDIYPPPVLENSERRSVTPPKNSNF------TSSRP 120

  Fly    67 AGYTLKRS---PSDLGEQQQP----------------PRQISRSP-------------------- 92
            :  .:.||   ||:...|:.|                .|...:||                    
Yeast   121 S--DISRSISRPSERASQEDPFRFERDLDRQAEQYAASRHTCKSPANKEFQAADNFPFNFEQEDA 183

  Fly    93 GNT-----------AAYHLT---TAMLLNS----QQCGYLGQRLQSVLQQQHAQHQQSQSQTPSS 139
            |||           :...||   ||.::||    ...|.|.|:|... ||:.....:.:|:....
Yeast   184 GNTEREQDLSPIERSFMMLTQNDTASVVNSMNQTDNRGVLDQKLGKE-QQKEESSIEYESEGQQE 247

  Fly   140 DDGSQSGVTI---------LEEERRGGAAAASLFTIDSILGSRQQGGGTAPS-QGSHISSNGNQN 194
            |:.....:..         ||.|.          ..|....::|:...|.|. ...:::...|..
Yeast   248 DENDIESLNFEPDPKLQMNLENEP----------LQDDFPEAKQEEKNTEPKIPEINVTRESNTP 302

  Fly   195 GLTSNGISLGL----KRSGAES---PASPNSNSSSS 223
            .||.|.:...:    ..||.||   ..||..:|||:
Yeast   303 SLTMNALDSKIYPDDNFSGLESSKEQKSPGVSSSST 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
PXL1NP_013016.4 LIM1_UF1 556..614 CDD:188783
LIM 621..672 CDD:259829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.