DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and YHP1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:31/129 - (24%)
Similarity:55/129 - (42%) Gaps:35/129 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQ 403
            |::|.||  :..:|..|:..||:...|:...|.:|:.:.::.|:.|::||:|:|...:|.|    
Yeast   174 RRKRRRT--SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHK---- 232

  Fly   404 ERLRKLQEEQCGSTTNGTTNSSSGTTSST---GNGSLTVKCPGSDHYSAQLVHIKSDPNGYSDA 464
                                 :||.||..   .|.|:::     ..||...:.|.|.|....:|
Yeast   233 ---------------------NSGNTSHCKVHSNDSMSM-----ISYSDAALEITSTPTSTKEA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 15/52 (29%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.