DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and PHO2

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:40/146 - (27%)
Similarity:66/146 - (45%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 HHPHH-----PHGHPHHPHLGAHHHGQH--------HLSHLGHGPPPKRKRRHRTIFTEEQLEQL 355
            |...|     |...|.......|.|.||        :.|..|    |:|.:|.|.  ..|.|:.|
Yeast    34 HDQQHNQQQQPQPQPIQTQNLEHDHDQHTNDMSASSNASDSG----PQRPKRTRA--KGEALDVL 92

  Fly   356 EATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWR-KQKREEQERLRKLQEEQCGST-T 418
            :..|:....|.:|.|::::..:.:.|:.|.:||:|||||.| ||....::.:...|.....:. .
Yeast    93 KRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYD 157

  Fly   419 NGTTNSSSGTTSSTGN 434
            .|:|:::..||:||.:
Yeast   158 RGSTDNNLVTTTSTSS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 17/52 (33%)
PHO2NP_010177.1 COG5576 53..183 CDD:227863 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.