DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and crx

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_694419.1 Gene:crx / 81881 ZFINID:ZDB-GENE-010403-1 Length:281 Species:Danio rerio


Alignment Length:106 Identity:49/106 - (46%)
Similarity:69/106 - (65%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LSHLGHGPP--PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKN 390
            |.|...|.|  |:::||.||.||..||:.|||.|.||.|||:.:||::|||::|.|.||:|||||
Zfish    24 LLHTAVGYPATPRKQRRERTTFTRTQLDILEALFTKTRYPDIFMREEVALKINLPESRVQVWFKN 88

  Fly   391 RRAKWRKQKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSS 431
            ||||.|:|:::...:.:....::..|.....| |..||:||
Zfish    89 RRAKCRQQQQQTSGQPKPRPPKKKSSPPPDLT-SDPGTSSS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 35/55 (64%)
crxNP_694419.1 homeodomain 38..97 36/58 (62%)
Homeodomain 49..94 CDD:459649 29/44 (66%)
TF_Otx 152..230 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.