DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and ESX1

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_703149.1 Gene:ESX1 / 80712 HGNCID:14865 Length:406 Species:Homo sapiens


Alignment Length:68 Identity:41/68 - (60%)
Similarity:57/68 - (83%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GP-PPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
            || ||:||||.||.||:.||::||..||::.|||||.||:||.:::|.|:||:|||:||||||::
Human   132 GPQPPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKWKR 196

  Fly   398 QKR 400
            .:|
Human   197 NQR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 34/55 (62%)
ESX1NP_703149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..142 7/9 (78%)
PLN02328 45..>148 CDD:215187 11/15 (73%)
Nuclear localization signal. /evidence=ECO:0000255 138..143 4/4 (100%)
Homeodomain 140..196 CDD:459649 34/55 (62%)
15 X 9 AA tandem repeats of P-P-x-x-P-x-P-P-x 244..378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..364
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.