powered by:
Protein Alignment Gsc and mxtx2
DIOPT Version :9
Sequence 1: | NP_001137762.2 |
Gene: | Gsc / 33240 |
FlyBaseID: | FBgn0010323 |
Length: | 473 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001073284.1 |
Gene: | mxtx2 / 58078 |
ZFINID: | ZDB-GENE-000710-6 |
Length: | 296 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 26/59 - (44%) |
Similarity: | 38/59 - (64%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 341 RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQK 399
||.||.||:|.||.|:..|:...||.:.:||.|:....|.|.|::|||:|:||:..|.:
Zfish 23 RRKRTSFTKEHLELLKMAFNVDPYPGISVRESLSQATGLPESRIQVWFQNKRARTLKNR 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gsc | NP_001137762.2 |
Homeobox |
343..396 |
CDD:278475 |
23/52 (44%) |
mxtx2 | NP_001073284.1 |
HOX |
22..76 |
CDD:197696 |
24/52 (46%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6207 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.