DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and CG34367

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:154 Identity:49/154 - (31%)
Similarity:68/154 - (44%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PPPKRKRRH----------------RTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEER 383
            |.|.|.|.|                ||.||.:||.:||..|::|||||..:||:|:.::.|.|.|
  Fly   171 PEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEAR 235

  Fly   384 VEVWFKNRRAKWRKQKREEQE------------------------RLRKLQEEQCGSTTNGTTNS 424
            |:|||:|||||.||.:.:..:                        .|..|:.....|.....|:|
  Fly   236 VQVWFQNRRAKCRKHENQMHKGFLVGSRSPPIATPLEPCRVAPYVSLAALRSSSVPSHPAAATSS 300

  Fly   425 S------SGTTSSTGNGSLTVKCP 442
            :      |||:||  ...:||..|
  Fly   301 NPQAPGVSGTSSS--GKVVTVDSP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 31/71 (44%)
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 29/55 (53%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.