DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and CG34367

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:154 Identity:49/154 - (31%)
Similarity:68/154 - (44%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PPPKRKRRH----------------RTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEER 383
            |.|.|.|.|                ||.||.:||.:||..|::|||||..:||:|:.::.|.|.|
  Fly   171 PEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEAR 235

  Fly   384 VEVWFKNRRAKWRKQKREEQE------------------------RLRKLQEEQCGSTTNGTTNS 424
            |:|||:|||||.||.:.:..:                        .|..|:.....|.....|:|
  Fly   236 VQVWFQNRRAKCRKHENQMHKGFLVGSRSPPIATPLEPCRVAPYVSLAALRSSSVPSHPAAATSS 300

  Fly   425 S------SGTTSSTGNGSLTVKCP 442
            :      |||:||  ...:||..|
  Fly   301 NPQAPGVSGTSSS--GKVVTVDSP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/68 (44%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 29/52 (56%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.