DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and drgx

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001032182.1 Gene:drgx / 560399 ZFINID:ZDB-GENE-070330-1 Length:287 Species:Danio rerio


Alignment Length:88 Identity:45/88 - (51%)
Similarity:60/88 - (68%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEE 382
            |..:..|.|.......|...:::||:||.||.:|||.|||.|.:||||||..||:||:|::|.|.
Zfish    20 LNTNGFGNHASGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFAREELAMKINLTEA 84

  Fly   383 RVEVWFKNRRAKWRKQKREEQER 405
            ||:|||:||||||||.:|...|:
Zfish    85 RVQVWFQNRRAKWRKTERGTSEQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 37/55 (67%)
drgxNP_001032182.1 Homeodomain 43..99 CDD:459649 37/55 (67%)
OAR 207..224 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.