Sequence 1: | NP_001137762.2 | Gene: | Gsc / 33240 | FlyBaseID: | FBgn0010323 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017625.1 | Gene: | dmbx1b / 550288 | ZFINID: | ZDB-GENE-050417-97 | Length: | 369 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 68/212 - (32%) |
---|---|---|---|
Similarity: | 103/212 - (48%) | Gaps: | 52/212 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 GLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG-----------HGPPPKRKRRH 343
Fly 344 RTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE-EQERLR 407
Fly 408 KLQEEQCGSTTNGTTNSSSGTTSSTGNGS-----LTVKCP-----GSDHYSAQLVHIKSDPN--- 459
Fly 460 -----GYSDADESSDLE 471 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsc | NP_001137762.2 | Homeobox | 343..396 | CDD:278475 | 36/52 (69%) |
dmbx1b | NP_001017625.1 | Homeobox | 69..122 | CDD:278475 | 36/52 (69%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..253 | 17/93 (18%) | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 346..359 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 1 | 1.000 | - | - | X6207 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |