DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and dmbx1b

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001017625.1 Gene:dmbx1b / 550288 ZFINID:ZDB-GENE-050417-97 Length:369 Species:Danio rerio


Alignment Length:212 Identity:68/212 - (32%)
Similarity:103/212 - (48%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 GLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG-----------HGPPPKRKRRH 343
            |::|:..|..:.....::.|..|..|.||        |...|.           :|...:::||.
Zfish     5 GVNGYSLHAMNSLSAMYNLHQQAAQHAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRS 69

  Fly   344 RTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE-EQERLR 407
            ||.||.:|||.||.||.||||||||:||:||:..:|.|.||:|||||||||:||::|. ::|:|:
Zfish    70 RTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQ 134

  Fly   408 KLQEEQCGSTTNGTTNSSSGTTSSTGNGS-----LTVKCP-----GSDHYSAQLVHIKSDPN--- 459
            :|:|              :||..:...|.     :..:.|     |....||....:..:.|   
Zfish   135 RLKE--------------AGTEGAQDEGKEEAPPVEAQAPPSPLDGRGLTSAPSCELNEEVNVTS 185

  Fly   460 -----GYSDADESSDLE 471
                 ..|.|::::|.|
Zfish   186 PEQSGAESGAEDTTDRE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 36/52 (69%)
dmbx1bNP_001017625.1 Homeobox 69..122 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..253 17/93 (18%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 346..359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 1 1.000 - - X6207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.