DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and lhx8

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_012816489.1 Gene:lhx8 / 548653 XenbaseID:XB-GENE-494997 Length:385 Species:Xenopus tropicalis


Alignment Length:61 Identity:22/61 - (36%)
Similarity:38/61 - (62%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
            ||..:|.||.||.:||:.::|.|.:.:.||....::|:.:..|....::|||:|.||:.:|
 Frog   251 PKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLSERTGLSRRVIQVWFQNCRARHKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 18/52 (35%)
lhx8XP_012816489.1 LIM1_Lhx7_Lhx8 103..158 CDD:188767
LIM2_Lhx7_Lhx8 165..219 CDD:188769
Homeobox 258..311 CDD:365835 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.