DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Pdlim1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_058557.2 Gene:Pdlim1 / 54132 MGIID:1860611 Length:327 Species:Mus musculus


Alignment Length:196 Identity:36/196 - (18%)
Similarity:55/196 - (28%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGGGTTTTTPSTTPDIPPSK------------------AKFKITVVSTPSPS-------PPPTPP 50
            |.....:..|.|....|.::                  :.|...|.|..|.|       |...|.
Mouse   117 GSAHNRSAMPFTASPAPSTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPVVQPH 181

  Fly    51 PAGS-----------MLAQMVETNSPPAGYTL---------------KRSPSDLGEQQQPPRQIS 89
            |:||           ||.:..|.|.||...|.               ...||.....:.|..:::
Mouse   182 PSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKAPVTKVA 246

  Fly    90 RSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVL--QQQHAQHQQSQSQTPSSDDGSQSGVTILEE 152
            .|.||.....:          |...|..:..|.  .:.|.:|.:....|....:..|.|...:|:
Mouse   247 ASVGNAQKLPI----------CDKCGTGIVGVFVKLRDHHRHPECYVCTDCGINLKQKGHFFVED 301

  Fly   153 E 153
            :
Mouse   302 Q 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
Pdlim1NP_058557.2 PDZ_signaling 5..81 CDD:238492
DUF4749 136..228 CDD:292558 17/91 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..184 7/22 (32%)
LIM_CLP36 258..309 CDD:188832 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.