Sequence 1: | NP_001137762.2 | Gene: | Gsc / 33240 | FlyBaseID: | FBgn0010323 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058557.2 | Gene: | Pdlim1 / 54132 | MGIID: | 1860611 | Length: | 327 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 36/196 - (18%) |
---|---|---|---|
Similarity: | 55/196 - (28%) | Gaps: | 63/196 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 GGGGTTTTTPSTTPDIPPSK------------------AKFKITVVSTPSPS-------PPPTPP 50
Fly 51 PAGS-----------MLAQMVETNSPPAGYTL---------------KRSPSDLGEQQQPPRQIS 89
Fly 90 RSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVL--QQQHAQHQQSQSQTPSSDDGSQSGVTILEE 152
Fly 153 E 153 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsc | NP_001137762.2 | Homeobox | 343..396 | CDD:278475 | |
Pdlim1 | NP_058557.2 | PDZ_signaling | 5..81 | CDD:238492 | |
DUF4749 | 136..228 | CDD:292558 | 17/91 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..184 | 7/22 (32%) | |||
LIM_CLP36 | 258..309 | CDD:188832 | 9/45 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |