DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gsc and PITX1

DIOPT Version :9

Sequence 1:	NP_001137762.2	Gene:	Gsc / 33240	FlyBaseID:	FBgn0010323	Length:	473	Species:	Drosophila melanogaster
Sequence 2:	NP_002644.4	Gene:	PITX1 / 5307	HGNCID:	9004	Length:	314	Species:	Homo sapiens

Alignment Length:	133	Identity:	53/133 - (39%)
Similarity:	68/133 - (51%)	Gaps:	33/133 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   332 GHGPPPKRK--RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAK 394
            |...|.|:|  ||.||.||.:||::|||||.:..|||:.:||::|:..:|.|.||.|||||||||
Human    79 GADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAK 143

  Fly   395 WRKQKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHYSAQLVHIKSDPN 459
            |||::|.:|..|.|          .|.....||...           |..|.|:|
Human   144 WRKRERNQQLDLCK----------GGYVPQFSGLVQ-----------PYEDVYAA---------- 177

  Fly   460 GYS 462
            |||
Human   178 GYS 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gsc	NP_001137762.2	Homeobox	343..396	CDD:278475	30/52 (58%)
PITX1	NP_002644.4	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..103		12/23 (52%)
		COG5576	36..>146	CDD:227863	37/66 (56%)
		Homeobox	93..146	CDD:395001	31/52 (60%)
		Interaction with PIT-1. /evidence=ECO:0000250	147..279		14/65 (22%)
		OAR	276..293	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	280..293
		Nuclear localization signal. /evidence=ECO:0000255	286..290
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940