DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and PAX4

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001353039.1 Gene:PAX4 / 5078 HGNCID:8618 Length:351 Species:Homo sapiens


Alignment Length:107 Identity:43/107 - (40%)
Similarity:52/107 - (48%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 PHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLK 380
            ||.|         |....|..|....|:||||:..|.|.||..|.:..|||.|.|.:||....|.
Human   155 PHSG---------SETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLP 210

  Fly   381 EERVEVWFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNGTT 422
            |:.|.|||.|||||||:     ||:|:  .|.|....:.|.|
Human   211 EDTVRVWFSNRRAKWRR-----QEKLK--WEMQLPGASQGLT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 29/55 (53%)
PAX4NP_001353039.1 PAX 5..129 CDD:128645
Homeodomain 172..227 CDD:459649 29/54 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.