DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Rhox8

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001020947.1 Gene:Rhox8 / 503423 RGDID:1561047 Length:178 Species:Rattus norvegicus


Alignment Length:92 Identity:36/92 - (39%)
Similarity:46/92 - (50%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 PHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLR 370
            |....||...|.|                |....:.|||  |||.||::||..|::.|||....|
  Rat   101 PGSTKGHQASPRL----------------PGQLSRNRHR--FTEFQLQELERIFERNHYPSAAAR 147

  Fly   371 EQLALKVDLKEERVEVWFKNRRAKWRK 397
            .:||..:.:.|.|||.|||:||||:||
  Rat   148 RELARWIGVTESRVENWFKSRRAKYRK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 28/55 (51%)
Rhox8NP_001020947.1 Homeodomain 119..174 CDD:459649 28/56 (50%)

Return to query results.
Submit another query.