DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and hbn

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:171 Identity:63/171 - (36%)
Similarity:75/171 - (43%) Gaps:67/171 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 HPHHPHGHPHHPHLGAHHH-----GQHHLSHL--------------------------------- 331
            |||  ||||||.|   |.|     |.:||||.                                 
  Fly    62 HPH--HGHPHHIH---HLHSSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTN 121

  Fly   332 -------------------GHG----PPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQL 373
                               ||.    ..|::.||.||.||..||.|||..|:||.||||..||.|
  Fly   122 TDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDL 186

  Fly   374 ALKVDLKEERVEVWFKNRRAKWRK-QKREEQERLRKLQEEQ 413
            |:::||.|.||:|||:|||||||| :|...|::...|..||
  Fly   187 AMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/52 (63%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.