DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and pax3

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_012825755.1 Gene:pax3 / 448464 XenbaseID:XB-GENE-482740 Length:486 Species:Xenopus tropicalis


Alignment Length:69 Identity:42/69 - (60%)
Similarity:50/69 - (72%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQK 399
            |.||| ||.||.||.||||:||..|::|||||:..||:||.:..|.|.||:|||.||||:||||.
 Frog   216 PLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQA 280

  Fly   400 REEQ 403
            ...|
 Frog   281 GANQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 34/55 (62%)
pax3XP_012825755.1 PAX 35..162 CDD:238076
Homeodomain 222..278 CDD:459649 34/55 (62%)
Pax7 349..393 CDD:403540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.